|
| HNF-6/ONECUT1 Rabbit mAb |
|
| LTA24773 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the Cut homeobox family of transcription factors. Expression of the encoded protein is enriched in the liver, where it stimulates transcription of liver-expressed genes, and antagonizes glucocorticoid-stimulated gene transcription. This gene may influence a variety of cellular processes including glucose metabolism, cell cycle regulation, and it may also be associated with cancer. Alternative splicing results in multiple transcript variants. |
|
| HNF6; HNF-6; HNF6A |
|
| 3175,Hepatocyte nuclear factor 6,HNF 6,HNF6,HNF6A,One cut domain family member 1,one cut homeobox 1,ONECUT1,HNF-6,hepatocyte nuclear factor 6,alpha,one cut domain family member 1,Q9UBC0,One Cut Homeobox 1,One Cut Domain Family Member 1,Hepatocyte Nuclear Factor 6,Alpha,One Cut Domain,Family Member 1 |
|
| Human |
|
| 3175 |
|
| Q9UBC0 |
|
| PYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEI |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 167-292 of human HNF-6/ONECUT1 (NP_004489.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IHC-P, ELISA |
|
| Mouse, Rat |
|
| 51kDa |
|
| IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using HNF-6/ONECUT1 Rabbit mAb (LTA24773) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
