|
| HLA-DPB1 Rabbit mAb |
|
| LTA24811 |
|
| 100ul |
|
|
$750
In stock
|
|
| HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. |
|
| DPB1; HLA-DP; HLA-DPB; HLA-DP1B |
|
| 3115,HLA-DPB1,DPB1,HLA-DP,HLA-DP1B,HLA-DPB,major histocompatibility complex,class II,DP beta 1,HLA class II histocompatibility antigen,DP beta 1 chain,DP(W4) beta chain,HLA-DP histocompatibility type,beta-1 subunit,MHC HLA DPB1,MHC class II HLA-DP-beta-1,MHC class II antigen DPB1,P04440,HLA-DPB1 |
|
| Human |
|
| 3115 |
|
| P04440 |
|
| MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRA |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-DPB1 (NP_002112.3). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Mouse, Rat |
|
| 29kDa |
|
| IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of paraffin-embedded Mouse spleen tissue using HLA-DPB1 Rabbit mAb (LTA24811, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
