|
| GLYAT/GAT Rabbit mAb |
|
| LTA24786 |
|
| 100ul |
|
|
$750
In stock
|
|
| The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's. Two transcript variants encoding different isoforms have been found for this gene. |
|
| CAT; GAT; ACGNAT |
|
| 10249,sc-83833,GLYAT,ACGNAT,CAT,GAT,glycine-N-acyltransferase,glycine N-acyltransferase,AAc,HRP-1(CLP),acyl-CoA:glycine N-acyltransferase,aralkyl acyl-CoA N-acyltransferase,aralkyl acyl-CoA:amino acid N-acyltransferase,aralkyl-CoA N-acyltransferase,benzoyl-coenzyme A:glycine N-acyltransferase,glycine N-benzoyltransferase,Q6IB77,Glycine-N-Acyltransferase,Aralkyl Acyl-CoA:Amino Acid N-Acyltransferase,Benzoyl-Coenzyme A:Glycine N-Acyltransferase,Acyl-CoA:Glycine N-Acyltransferase,Aralkyl Acyl-CoA N-Acyltransferase,Glycine N-Benzoyltransferase,Aralkyl-CoA N-Acyltransferase,Glycine N-Acyltransferase,EC 2.3.1.13,EC 2.3.1.71 |
|
| Human |
|
| 10249 |
|
| Q6IB77 |
|
| MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQ |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GLYAT/GAT (NP_964011.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Rat |
|
| 34kDa |
|
| WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Rat kidney using GLYAT/GAT Rabbit mAb (LTA24786) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 30s. |
