|
| GLUT4 Rabbit mAb |
|
| LTA24830 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). |
|
| GLUT4 |
|
| 6517,sc-1608,sc-1606,sc-7938,GLUT 4,GLUT4,SLC2A4,solute carrier family 2 member 4,solute carrier family 2,facilitated glucose transporter member 4,GLUT-4,glucose transporter type 4,insulin-responsive,insulin-responsive glucose transporter type 4,solute carrier family 2 (facilitated glucose transporter),member 4,P14672,Solute Carrier Family 2 Member 4,Solute Carrier Family 2 (Facilitated Glucose Transporter),Member 4,Glucose Transporter Type 4,Insulin-Responsive,Solute Carrier Family 2,Facilitated Glucose Transporter Member 4,Insulin-Responsive Glucose Transporter Type 4 |
|
| Human |
|
| 6517 |
|
| P14672 |
|
| RPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVA |
|
| A synthetic peptide corresponding to a sequence within amino acids 271-370 of human GLUT4 (NP_001033.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Mouse |
|
| 55kDa |
|
| WB,1:1000 - 1:2000 |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Mouse skeletal muscle using GLUT4 Rabbit mAb (LTA24830) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 45s. |
