|
| GDNF Receptor alpha 1/GFRA1 Rabbit mAb |
|
| LTA24749 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the glial cell line-derived neurotrophic factor receptor (GDNFR) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature receptor. Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. This receptor is a glycosylphosphatidylinositol (GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. |
|
| GDNFR; RET1L; RETL1; RHDA4; TRNR1; GDNFRA; GFRalpha-1; GFR-ALPHA-1; GDNFR-alpha-1 |
|
| 2674,sc-6157,sc-10716,GFRA1,GDNFR,GDNFRA,GFR-ALPHA-1,RET1L,RETL1,TRNR1,GDNF family receptor alpha 1,GDNF family receptor alpha-1,GDNFR-alpha-1,GPI-linked anchor protein,Glial cell line-derived neurotrophic factor receptor alpha,PI-linked cell-surface accessory protein,RET ligand 1,TGF-beta-related neurotrophic factor receptor 1,P56159,GDNF Family Receptor Alpha 1,TGF-Beta-Related Neurotrophic Factor Receptor 1,GDNFR-Alpha-1,RET Ligand 1,Glial Cell Line-Derived Neurotrophic Factor Receptor Alpha,PI-Linked Cell-Surface Accessory Protein,GDNF Family Receptor Alpha-1,GPI-Linked Anchor Protein,GDNF Receptor Alpha-1,GFR-Alpha-1 |
|
| Human |
|
| 2674 |
|
| P56159 |
|
| QTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNYEKEGLGASSHITTKSMAAPPSCGLSPLLVLVVTALSTLLS |
|
| A synthetic peptide corresponding to a sequence within amino acids 361-460 of human GDNF Receptor alpha 1/GFRA1 (NP_005255.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human, Mouse, Rat |
|
| 51kDa |
|
| IF/ICC,1:100 - 1:400|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Immunofluorescence analysis of MCF7 cells using GDNF Receptor alpha 1/GFRA1 Rabbit mAb (LTA24749) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(LT007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
