|
| _-Tubulin Rabbit mAb |
|
| LTA24701 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7. |
|
| TUBG; GCP-1; CDCBM4; TUBGCP1; _-Tubulin |
|
| TUBG1, CDCBM4, GCP-1, TUBG, TUBGCP1, tubulin gamma 1, tubulin gamma-1 chain|gamma-tubulin complex component 1|tubulin, gamma polypeptide, P23258, marker, Centrosome, Centrosome marker, _-Tubulin |
|
| Human |
|
| 7283 |
|
| P23258 |
|
| LVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQEQ |
|
| Recombinant protein of human _-Tubulin. |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 51kDa |
|
| WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates, using _-Tubulin Rabbit mAb (LTA24701) at1:1000 dilution.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25_g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 20s. |
