|
| GABARAPL1 Rabbit mAb |
|
| LTA24763 |
|
| 100ul |
|
|
$750
In stock
|
|
| Enables Tat protein binding activity and ubiquitin protein ligase binding activity. Predicted to be involved in autophagosome assembly; autophagy of mitochondrion; and cellular response to nitrogen starvation. Located in autophagosome. Colocalizes with mitochondrion. |
|
| ATG8; GEC1; APG8L; ATG8B; ATG8L; APG8-LIKE |
|
| 23710,APG8 LIKE,APG8L,ATG8,ATG8L,GABARAPL1,GEC 1,GEC1,APG8-LIKE,ATG8B,GABA type A receptor associated protein like 1,gamma-aminobutyric acid receptor-associated protein-like 1,GABA(A) receptor-associated protein-like 1,GABARAPL1-a,GEC-1,early estrogen-regulated protein,glandular epithelial cell protein 1,Q9H0R8,GABA Type A Receptor Associated Protein Like 1,GABA(A) Receptor-Associated Protein-Like 1,Glandular Epithelial Cell Protein 1,Early Estrogen-Regulated Protein,Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1,GABA(A) Receptor-Associated Protein Like 1,GABARAPL1-A |
|
| Human |
|
| 23710 |
|
| Q9H0R8 |
|
| MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHE |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAPL1 (NP_113600.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 14kDa |
|
| WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates using GABARAPL1 Rabbit mAb (LTA24763) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 30s. |
