|
| Foxp3 Rabbit mAb |
|
| LTA24816 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene result in the scurfy phenotype (sf). Alternative splicing results in multiple transcript variants. |
|
| sf; JM2; scurfin |
|
| sf; JM2; scurfin |
|
| Human |
|
| 20371 |
|
| Q99JB6 |
|
| MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of Mouse Foxp3 (NP_473380.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Mouse |
|
| 47kDa |
|
| WB,1:1000 - 1:10000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with Foxp3 using Foxp3 Rabbit mAb (LTA24816) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 20 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020)|.Exposure time: 0.5s. |
