|
| FGF23 Rabbit mAb |
|
| LTA24792 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). |
|
| ADHR; FGFN; HYPF; HFTC2; HPDR2; PHPTC |
|
| 8074,sc-16849,sc-27249,sc-50292,FGF23,ADHR,FGFN,HPDR2,HYPF,PHPTC,fibroblast growth factor 23,phosphatonin,tumor-derived hypophosphatemia inducing factor,Q9GZV9,Fibroblast Growth Factor 23,Phosphatonin,Tumor-Derived Hypophosphatemia Inducing Factor,Tumor-Derived Hypophosphatemia-Inducing Factor,FGF-23 |
|
| Human |
|
| 8074 |
|
| Q9GZV9 |
|
| YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 25-251 of human FGF23 (NP_065689.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 28kDa |
|
| WB,1:9000 - 1:54000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from 293T cells using FGF23 Rabbit mAb (LTA24792) at 1:9000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 20 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 5s. |
