|
| ENO3 Rabbit mAb |
|
| LTA24805 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described. |
|
| MSE; GSD13 |
|
| 2027,sc-133550,Beta enolase,ENO3,ENO3-specific,Enolase 3,enolase 3 (beta,muscle),MSE,Muscle specific enolase,Skeletal muscle enolase,GSD13,enolase 3,beta-enolase,2-phospho-D-glycerate hydrolyase,muscle enriched enolase,muscle-specific enolase,skeletal muscle enolase,P13929,Enolase 3 (Beta,Muscle),Muscle-Specific Enolase,Skeletal Muscle Enolase,Muscle Enriched Enolase,Beta-Enolase,2-Phospho-D-Glycerate Hydro-Lyase,2-Phospho-D-Glycerate Hydrolyase,(Beta,EC 4.2.1.11 |
|
| Human |
|
| 2027 |
|
| P13929 |
|
| MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGT |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENO3 (NP_001967.3). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 47kDa |
|
| WB,1:3000 - 1:12000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates using ENO3 Rabbit mAb (LTA24805) at 1:3000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 30s. |
