|
| Endomucin Rabbit mAb |
|
| LTA24784 |
|
| 100ul |
|
|
$750
In stock
|
|
| EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]). |
|
| EMCN2; MUC14 |
|
| 51705,sc-19901,sc-19900,EMCN,EMCN2,MUC14,endomucin,MUC-14,endomucin-2,gastric cancer antigen Ga34,mucin-14,Q9ULC0,Endomucin,Gastric Cancer Antigen Ga34,Endomucin-2,Mucin-14 |
|
| Human |
|
| 51705 |
|
| Q9ULC0 |
|
| LYRMCWKADPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 212-261 of human Endomucin (NP_057326.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IHC-P, ELISA |
|
| Mouse |
|
| 27kDa |
|
| IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Endomucin Rabbit mAb (LTA24784) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
