|
| Cyclin D2 Rabbit mAb |
|
| LTA24713 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK4 or CDK6 and functions as a regulatory subunit of the complex, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. Mutations in this gene are associated with megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome 3 (MPPH3). |
|
| MPPH3; KIAK0002 |
|
| 894,sc-754,sc-181,CCND2,cyclin D2,G1/S-specific cyclin-D2,KIAK0002,MPPH3,P30279,Cyclin D2,G1/S-Specific Cyclin-D2,G1/S-Specific Cyclin D2 |
|
| Human |
|
| 894 |
|
| P30279 |
|
| LLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPS |
|
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cyclin D2 (NP_001750.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 33kDa |
|
| WB,1:3500 - 1:7000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from U-2 OS cells using Cyclin D2 Rabbit mAb (LTA24713) at 1:7000 dilution .|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Enhanced Kit (LT00021).|Exposure time: 90s(__). |
