|
| CSNK2A2 Rabbit mAb |
|
| LTA24705 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes the alpha', or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythms. This heterotetrameric kinase includes two catalytic subunits, either alpha or alpha', and two regulatory beta subunits. The closely related gene paralog encoding the alpha, or alpha 1 subunit (CSNK2A1, Gene ID: 1457) is found on chromosome 20. An intronic variant in this gene (alpha 2) may be associated with leukocyte telomere length in a South Asian population. A related transcribed pseudogene is found on chromosome 11. |
|
| CK2A2; CSNK2A1; CK2alpha' |
|
| 1459,sc-6481,Casein kinase II subunit alpha,CK II alpha,CK2A2,CSNK2A1,CSNK2A2,CK2alpha',casein kinase 2 alpha 2,casein kinase II subunit alpha',CK II alpha',casein kinase 2 alpha',casein kinase 2,alpha prime polypeptide,P19784,Casein Kinase 2 Alpha 2,Casein Kinase 2,Alpha Prime Polypeptide,Casein Kinase 2 Alpha,CK II Alpha,Casein Kinase II Subunit Alpha,EC 2.7.11.1,CK2alpha |
|
| Human |
|
| 1459 |
|
| P19784 |
|
| LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
|
| A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CSNK2A2 (NP_001887.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 41kDa |
|
| WB,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates using CSNK2A2 Rabbit mAb (LTA24705) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 30s. |
