|
| Collagen IV Rabbit mAb |
|
| LTA24798 |
|
| 100ul |
|
|
$750
In stock
|
|
| Type IV collagen, the major structural component of basement membranes, is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. This gene encodes alpha 3. In the Goodpasture syndrome, autoantibodies bind to the collagen molecules in the basement membranes of alveoli and glomeruli. The epitopes that elicit these autoantibodies are localized largely to the non-collagenous C-terminal domain of the protein. A specific kinase phosphorylates amino acids in this same C-terminal region and the expression of this kinase is upregulated during pathogenesis. This gene is also linked to an autosomal recessive form of Alport syndrome. The mutations contributing to this syndrome are also located within the exons that encode this C-terminal region. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter. |
|
| ATS2; ATS3; BFH2 |
|
| 1285,COL4A3,collagen type IV alpha 3 chain,collagen alpha-3(IV) chain,collagen IV,alpha-3 polypeptide,collagen,type IV,alpha 3 (Goodpasture antigen),tumstatin,Q01955,Collagen Type IV Alpha 3 Chain,Collagen,Type IV,Alpha 3 (Goodpasture Antigen),Tumstatin,Collagen IV,Alpha-3 Polypeptide,Collagen Alpha-3(IV) Chain,Goodpasture Antigen |
|
| Human |
|
| 1285 |
|
| Q01955 |
|
| AIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKR |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 1555-1669 of human Collagen IV (NP_000082.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human |
|
| 162kDa |
|
| IF/ICC,1:100 - 1:400|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of U266 cells using Collagen IV Rabbit mAb (LTA24798, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x. |
