|
| CHAT Rabbit mAb |
|
| LTA24765 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform. |
|
| CMS6; CMS1A; CMS1A2; CHOACTASE |
|
| 1103,sc-19056,sc-19057,sc-20672,CHAT,CHOACTase,Choline acetylase,choline acetyltransferase,Choline O acetyltransferase,CMS1A,CMS1A2,CHOACTASE,CMS6,choline O-acetyltransferase,acetyl CoA:choline O-acetyltransferase,choline acetylase,P28329,Choline O-Acetyltransferase,Choline Acetylase,Acetyl CoA:Choline O-Acetyltransferase,Choline Acetyltransferase,EC 2.3.1.6,ChAT |
|
| Human |
|
| 1103 |
|
| P28329 |
|
| VTQSSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIR |
|
| A synthetic peptide corresponding to a sequence within amino acids 461-560 of human CHAT (NP_065574.4). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| IF/ICC, ELISA |
|
| Human, Mouse, Rat |
|
| 83kDa |
|
| IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Confocal imaging of paraffin-embedded Mouse brain tissue using CHAT Rabbit mAb (LTA24765, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (LT007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
