|
| CD3E Rabbit mAb |
|
| LTA24700 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. |
|
| T3E; TCRE; IMD18; CD3epsilon; CD3E |
|
| 916, sc-1127, sc-26249, sc-20918, CD3, CD3 epsilon, CD3E, CD3-epsilon, T3E, TCRE, IMD18, CD3e molecule, T-cell surface glycoprotein CD3 epsilon chain, CD3e antigen, epsilon polypeptide (TiT3 complex), epsilon (CD3-TCR complex), T-cell antigen receptor complex, epsilon subunit of T3, T-cell surface antigen T3/Leu-4 epsilon chain, P07766, CD3e Molecule, CD3e Antigen, Epsilon Polypeptide (TiT3 Complex), T-Cell Surface Antigen T3/Leu-4 Epsilon Chain, Epsilon (CD3-TCR Complex), T-Cell Antigen Receptor Complex, Epsilon Subunit Of T3, T-Cell Surface Glycoprotein CD3 Epsilon Chain, CD3-Epsilon, CD3E Antigen, T-cell surface glycoprotein CD3 epsilon chainCD3-epsilonCD3e antigen, epsilon polypeptide (TiT3 complex)CD3e molecule, epsilon (CD3-TCR complex)T-cell antigen receptor complex, epsilon subunit of T3T-cell surface antigen T3/Leu-4 epsilon chain |
|
| Human |
|
| 916 |
|
| P07766 |
|
| AKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
|
| A synthetic peptide corresponding to a sequence within amino acids 158-207 of human CD3E (NP_000724.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, IHC-P, ELISA |
|
| Human, Mouse, Rat |
|
| 23kDa |
|
| WB,1:500 - 1:1000|IHC-P,1:2000 - 1:7000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of various lysates, using CD3E Rabbit mAb (LTA24700) at 1:1000 dilution.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25_g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 3s. |
