|
| CD244 Rabbit mAb |
|
| LTA24770 |
|
| 100ul |
|
|
$750
In stock
|
|
| This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
|
| 2B4; NAIL; Nmrk; NKR2B4; SLAMF4 |
|
| 51744,sc-18167,sc-18165,CD244,2B4,NAIL,NKR2B4,Nmrk,SLAMF4,CD244 molecule,natural killer cell receptor 2B4,NK cell activation inducing ligand NAIL,NK cell activation-inducing ligand,NK cell type I receptor protein 2B4,SLAM family member 4,h2B4,signaling lymphocytic activation molecule 4,Q9BZW8,Cd244,CD244 Molecule,Natural Killer Cell Receptor 2B4,Signaling Lymphocytic Activation Molecule 4,NK Cell Type I Receptor Protein 2B4,NK Cell Activation-Inducing Ligand,SLAM Family Member 4,H2B4,NK Cell Activation Inducing Ligand NAIL,CD244 Natural Killer Cell Receptor 2B4,CD244 Antigen |
|
| Human |
|
| 51744 |
|
| Q9BZW8 |
|
| CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNA |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 22-221 of human CD244 (NP_001160135.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human |
|
| 42kDa |
|
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from U-937 cells using CD244 Rabbit mAb (LTA24770) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 180s. |
