|
| ATP2B1 Rabbit mAb |
|
| LTA24762 |
|
| 100ul |
|
|
$750
In stock
|
|
| The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 1. Alternatively spliced transcript variants encoding different isoforms have been identified. |
|
| MRD66; PMCA1; PMCA1kb |
|
| 490,ATP2B1,PMCA1,PMCA1kb,ATPase plasma membrane Ca2+ transporting 1,plasma membrane calcium-transporting ATPase 1,ATPase,Ca++ transporting,plasma membrane 1,plasma membrane calcium pump,P20020,ATPase Plasma Membrane Ca2+ Transporting 1,Plasma Membrane Calcium-Transporting ATPase 1,Ca++ Transporting,Plasma Membrane 1,Plasma Membrane Calcium ATPase Isoform 1,Plasma Membrane Calcium Pump Isoform 1,Plasma Membrane Calcium Pump,EC 3.6.3.8 |
|
| Human |
|
| 490 |
|
| P20020 |
|
| MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQ |
|
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATP2B1 (NP_001673.2). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Human, Mouse, Rat |
|
| 135kDa |
|
| WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Mouse liver using ATP2B1 Rabbit mAb (LTA24762) at 1:1000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 45s. |
