|
| AGER Rabbit mAb |
|
| LTA24758 |
|
| 100ul |
|
|
$750
In stock
|
|
| The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847). |
|
| RAGE; sRAGE; SCARJ1 |
|
| 177,sc-8230,sc-8229,sc-5563,AGER,RAGE,SCARJ1,advanced glycosylation end-product specific receptor,advanced glycosylation end product-specific receptor,RAGE isoform NtRAGE-delta,RAGE isoform sRAGE-delta,receptor for advanced glycation end-products variant 20,Q15109,Advanced Glycosylation End-Product Specific Receptor,Receptor For Advanced Glycation End-Products Variant 20,Advanced Glycosylation End Product-Specific Receptor,Receptor For Advanced Glycosylation End Products,Receptor For Advanced Glycation End-Products,RAGE Isoform NtRAGE-Delta,RAGE Isoform SRAGE-Delta |
|
| Human |
|
| 177 |
|
| Q15109 |
|
| QNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA |
|
| Recombinant fusion protein containing a sequence corresponding to amino acids 24-344 of human AGER (NP_001127.1). |
|
| Rabbit |
|
| Affinity Purified Monoclonal IgG |
|
| WB, ELISA |
|
| Mouse, Rat |
|
| 43kDa |
|
| WB,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 _g/mL. Please optimize the concentration based on your specific assay requirements. |
|
|
Reconstituted antibodies stable at -80C for 12 months, 4C for 1 week. Avoid repeated freeze-thaw cycles.
|
|
|
Shipped at ambient temperature.
|
|
|
Centrifuge tubes before opening. Dissolve the lyophilized antibodies in distilled water. 5-10% glycerol is recommended.
|
|
| .jpg )
Western blot analysis of lysates from Mouse lung using AGER Rabbit mAb (LTA24758) at 1:2000 dilution incubated overnight at 4_.|Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (LT014) at 1:10000 dilution.|Lysates/proteins: 25 _g per lane.|Blocking buffer: 3% nonfat dry milk in TBST.|Detection: ECL Basic Kit (LT00020).|Exposure time: 30s. |
