Vascular Endothelial Growth Factor Related Protein Rat Recombina

Product Name:Vascular Endothelial Growth Factor Related Protein Rat Recombinant

Catalog Number: LTP4461

Product Size: 10µg

Transportation method:Shipped at Room temp

Uniprot ACC#: P16612Growth Factors

Subcategory:VEGF

Amino acid sequence: DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH.

Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

Formulation:Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer.

Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.

Purity:Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

Source:Sf9, Insect Cells.

Stability:Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.

Synonyms: VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 5 Units in Stock

$270.40  $229.84
Save: 15% off

Add to Cart:
Copyright © 2019 LifeTein.com. Powered by LifeTein