Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant,

Product Name:Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant, Sf9

Catalog Number: LTP4456

Product Size: 10µg

Transportation method:Shipped at Room temp

Uniprot ACC#: P15692Growth Factors

Subcategory:VEGF

Amino acid sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.

Vascular Endothelial Growth Factor-121 Human Recombinant produced in insect cells as an 18kDa homodimer, is a glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of approximately 36kDa.VEGF121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates.The VEGF-121 is purified by proprietary chromatographic techniques.

Formulation:The protein was lyophilized from a solution containing 50mM acetic acid.

Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.

Purity:Greater than 95.0% as determined by SDS-PAGE.

Source:Sf9, Insect Cells.

Stability:Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Synonyms: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.

Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

  • 5 Units in Stock

$270.40  $229.84
Save: 15% off

Add to Cart:
Copyright © 2019 LifeTein.com. Powered by LifeTein