[Pyr3]-Amyloid β-Protein (3-42)

Product Name
[Pyr3]-Amyloid β-Protein (3-42), [Pyr3] - beta - Amyloid (3 - 42), Human
Product Description
It is one of the predominant Amyloid peptide structures deposited in human brain of Alzheimer's disease and Down's syndrome patients. It accumulates in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.
Product Quantity
1.0 mg
Purity
97.16%
Catalog Number
LT12021
Molecular Weight
4309.97
Formula
C196H299N53O55S, CAS #[183449-57-2]
Sequence
Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala, Pyr - FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
  • 4 Units in Stock

$190.00  $149.00
Save: 22% off

Add to Cart:
Copyright © 2019 LifeTein.com. Powered by LifeTein