Product Name:Helicobacter Pylori Outer Membrane Protein Recombinant
Catalog Number: LTP7157
Product Size: 500µg
Transportation method:Shipped with Ice Packs
Uniprot ACC#: Recombinant Proteins
Subcategory:Outer Membrane Protein
Amino acid sequence: MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.
Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.
Formulation:The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.
Physical Appearance:Sterile filtered liquid formulation.
Purity:Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Source:E.Coli
Stability:Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Synonyms:
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
