Product Name:Pramlintide
Catalog Number: LTP4546
Product Size: 4mg
Transportation method:Shipped at Room temp
Uniprot ACC#: Hormones
Subcategory:Peptide Hormones
Amino acid sequence: KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.
Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2.
Formulation:The protein was lyophilized with no additives.
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Purity:Greater than 95.0% as determined by HPLC.
Source:
Stability:Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Synonyms:
Usage:LifeTein's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.