| [Pyr3]-Amyloid β-Protein (3-42), [Pyr3] - beta - Amyloid (3 - 42), Human |
| It is one of the predominant Amyloid peptide structures deposited in human brain of Alzheimer's disease and Down's syndrome patients. It accumulates in the brain and to trigger the formation of insoluble amyloid β-peptide deposits. |
| 1.0 mg |
| 97.16% |
| LT12021 |
| 4309.97 |
| C196H299N53O55S, CAS #[183449-57-2] |
| Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala, Pyr - FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
