GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG

Product Name NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer configuration
Size 12 mg
Catalog # LT441773
US$ $1,200
Purity >95%
Description NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer configuration
Storage -20°C
Sequence
(One-Letter Code)
NH2-GRRRQRRKKRGGRGIEHISRGGDIMGEWGNEIFGAIAGFLG-COOH, All D-isomer configuration
  • 1 Units in Stock

$1,200.00

Add to Cart:
Copyright © 2019 LifeTein.com. Powered by LifeTein