Glucagon Human

$160.00  $89.00
Save: 44% off

Product Name
Glucagon, human CAS# 16941-32-5
Product Quantity
1 mg
Catalog Number
LT0541
Molecular Weight
3482.75
Formula
C153H225N43O49S
Sequence
H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH, HSQGTFTSDYSKYLDSRRAQDFVQWLMNT. A 29 amino acid sequence containing peptide hormone processed from proglucagon that keeps glucose homeostasis in vivo in both animals and humans. It is also believed to be a potential tool in the therapeutic treatment of diabetes.

Add to Cart:

  • 5 Units in Stock

Copyright © 2020 LifeTein.com. Powered by LifeTein